SKU: 69412719679

EPHB3 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 2 - Sep 7

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPHB3 ProteinProduct Specification Species Human Synonyms ETK2, HEK2, TYRO6 Accession P54753 Amino Acid Sequence K596 V998(end)

Product Specification


Species Human
Synonyms ETK2, HEK2, TYRO6
Accession P54753
Amino Acid Sequence

K596-V998(end)

KLQQYIAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREVFVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALDSFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYWDMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV

Expression System Baculovirus-InsectCells
Molecular Weight 72.2 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Liquid
Storage Buffer 50mM Tris, 150mM NaCl, 20mM Reduced Glu, 1mM DTT, 10% Glycerol, 0.05% Brij-35, 0.1mM PMSF, pH7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 69412719679

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Rae
Charlottesville, US
★★★★★ 3
Shining Shimmering Splendid
Color: Gold, Color: Gold
Alright, first of all I LOVE the packaging and the spray bottle. Absolutely adorable! Aesthetics are off the charts. As for the actual power and look of the glitter, it is pretty good. I tried to take photos of it on my hands/arms but the camera has a really hard time picking up the small glitter. In person it will give you a shiny or shimmery look rather than coated in gold. Not quite what I was hoping for, but definitely a cool look! The spray is quite powerful, so be aware of where you are putting it on. It is very easy to apply, just keep in mind that glitter will go EVERYWHERE. It also comes off easily enough either by rubbing a cloth or washing with water.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 9, 2025
C
Verified Purchase
Cristen
Battle Creek, US
★★★★★ 5
Great glitter body spray
Color: Fairy-Diamond, Color: Fairy-Diamond
So cute. Came with extra glitter, I’m assuming lipgloss you can make into glitter lipgloss, a funnel to help pour the glitter. Or re load your spray. The spray performance is nice. Might stick better with some oil before hand? But I like it so far. Worked 6 hours and still had glitter on me for my photoshoot. I sprayed perfume and then glitter. There’s no odor. The amount of quantity of glitter you get seems good for the price. Durability seems good so far but like I said may need some oil or lotion first to help it stick all day.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
D
Verified Purchase
Dawn
Boise, US
★★★★★ 5
Troll glitter
Color: Brandy-Rose
Do not spray too much! This glitter is so fine that it dispenses easily from the puff part and you can easily make yourself look like Poppy the troll. We had so much fun with this for prom
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
F
Verified Purchase
Frostfire
Cuba, US
★★★★★ 5
Glitter with staying power
Color: Rainy-Rainbow, Color: Rainy-Rainbow
Super fun and sparkly, the color is beautiful, it comes with 2 glue tubes with brushes that you use to rub the glue onto your skin in order for the sparkle to stick better and longer, made a heart shape on my arm, dries fairly quickly and washes off easily when you're done with it It sprays a fine layer and evenly, it's great for building on for more sparkle or to just have a light layer Even without the glue it lasts at least a couple hours with minimal shedding and light use, seems to have good longevity With 2 glue tubes, a refill tub, funnel and the glitter spray bottle I feel $10 is a great value considering everything you get with it, Overall I feel like it's a fantastic product and will buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 22, 2025
C
Verified Purchase
Customer
Lowell, US
★★★★★ 5
Super super glittery!
Color: Fairy-Diamond
Super, super glittery! I ended up returning because, believe it or not, it was too glittery for me! But it's a good product :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026

recommand products