SKU: 67380722774

Myoglobin His Tag Protein, Human

Sale price$360.00 Regular price$400.00
Save 10%

Pay in installments of $100.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 2 - Sep 7

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Myoglobin His Tag Protein, HumanProduct Specification Species Human Synonyms MB MGC13548 MYG_HUMAN Myoglobin Accession P02144 Amino Acid Sequence MHHHHHHDDDDKGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG Expression System E. coli Molecular Weight 18. 4kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <2EU g Conjugation Unconjugated Tag His Tag Physical

Product Specification


Species Human
Synonyms MB MGC13548 MYG_HUMAN Myoglobin
Accession P02144
Amino Acid Sequence MHHHHHHDDDDKGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Expression System E.coli
Molecular Weight 18.4kDa(Reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <2EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 20mM Tris,100mM NaCl, pH8.0
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Myoglobin (myoglobin,Mb) is a binding protein composed of a peptide chain and a heme auxiliary group. It is mainly distributed in myocardium and skeletal muscle. The increase of serum Mb level results from the release of skeletal muscle and / or cardiomyocyte injury (dissolution / necrosis) to blood circulation. Serum Mb < 70ng/ml, and its level varies with age, sex and race. Mb can be detected in serum in the early stage after myocardial infarction, and the peak time (1-2 hours) is earlier than creatine kinase (creatine kinase,CK). Mb is easy to be excreted from urine because of its small molecular weight. After reperfusion therapy, the level of serum Mb increases rapidly, so it has been used as a useful index to evaluate the success of reperfusion therapy or the size of myocardial infarction, but because the half-life of Mb is short (15 minutes), the level of serum Mb does not increase 6-12 hours after the attack of chest pain, which is helpful to rule out acute myocardial infarction. At the same time, because the duration of the increase of Mb level is very short (< 24 hours), the determination of Mb is helpful to observe whether there is re-infarction or infarction expansion in the course of acute myocardial infarction. The frequent increase of Mb level indicates that the original myocardial infarction is still persistent. It should be pointed out that Mb is also a component of skeletal muscle and lacks specificity, so the clinical value of a series of Mb determination after myocardial infarction is limited. For patients with chest discomfort and non-diagnostic electrocardiographic manifestations, acute myocardial infarction can not be diagnosed by Mb alone within the first 4-8 hours of onset, but should be supplemented by more specific examinations, such as CK-MB or cardiac troponin.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 67380722774

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Miriam Avila Sanchez
Lowell, US
★★★★★ 5
Needed for Sunday School
Color: Grey, Size: Wheel-6 Panel
This was purchase to divide two Sunday school children classes. It works wonderful, big enough, sturdy and with wheels, so is easy to move. Thanks God we can find everything in amazon.com. Delivery was fast and perfect. Thank you .
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 6, 2024
M
Verified Purchase
Melissa P
Phoenix, US
★★★★★ 3
Not as tall as anticipated
Color: Black, Size: Wheel-6 Panel
Definitely not 6 feet tall, more like 5 1/2. Very sturdy and the fabric is thick. Works well for what we're using it for.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2025
V
Verified Purchase
Vickie Dovel
Natrona Heights, US
★★★★★ 5
Easy to put together
Color: Grey, Size: Wheel-6 Panel
Love them
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 17, 2025
V
Verified Purchase
Val
Port Orchard, US
★★★★★ 5
True to Description
Color: Black, Size: 4 Panel
Love it!! I bought it for privacy while the nurse is dressing my dad. There were several colors black matched the decor . It blocked the sunlight and street lights. Durability and quality very good. Easy closure when not in use. Lightweight. No assembly needed
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
C
Verified Purchase
Clockworks
Port Orchard, US
★★★★★ 5
Nice room divider!
Color: White, Size: 8 Panel
The white panels are a nice off-white color. shipped in perfect condition. Already assembled so set up was quick. We use them to separate a photo studio from the main entry. Easily covers a 6 Ft. opening to the room. They are a woven material with wood colored sticks to support the weave. They are about 6 Ft. tall at the top of the curved section but less at the hinged sections. Light and easy to set up and take down. We are straddling two different floors so the extended legs at the bottom make this easy. Not sure how to clean them but they look great so far!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 21, 2025

recommand products